SDCCAG8 antibody (N-Term)
-
- Target See all SDCCAG8 Antibodies
- SDCCAG8 (serologically Defined Colon Cancer Antigen 8 (SDCCAG8))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SDCCAG8 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SDCCAG8 antibody was raised against the N terminal of SDCCAG8
- Purification
- Affinity purified
- Immunogen
- SDCCAG8 antibody was raised using the N terminal of SDCCAG8 corresponding to a region with amino acids HEETNMPTMHDLVHTINDQSQYIHHLEAEVKFCKEELSGMKNKIQVVVLE
- Top Product
- Discover our top product SDCCAG8 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SDCCAG8 Blocking Peptide, catalog no. 33R-3716, is also available for use as a blocking control in assays to test for specificity of this SDCCAG8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDCCAG8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SDCCAG8 (serologically Defined Colon Cancer Antigen 8 (SDCCAG8))
- Alternative Name
- SDCCAG8 (SDCCAG8 Products)
- Synonyms
- si:dkey-60b15.1 antibody, BBS16 antibody, CCCAP antibody, CCCAP SLSN7 antibody, NPHP10 antibody, NY-CO-8 antibody, SLSN7 antibody, hCCCAP antibody, 2700048G21Rik antibody, 5730470G24Rik antibody, Cccap antibody, serologically defined colon cancer antigen 8 antibody, sdccag8 antibody, SDCCAG8 antibody, Sdccag8 antibody
- Background
- SDCCAG8 encodes a centrosome associated protein. This protein may be involved in organizing the centrosome during interphase and mitosis. Mutations in this gene are associated with retinal-renal ciliopathy.
- Molecular Weight
- 83 kDa (MW of target protein)
- Pathways
- M Phase, Tube Formation
-