RALB antibody
-
- Target See all RALB (Ralb) Antibodies
- RALB (Ralb) (V-Ral Simian Leukemia Viral Oncogene Homolog B (Ras Related, GTP Binding Protein) (Ralb))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RALB antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- RALB antibody was raised using a synthetic peptide corresponding to a region with amino acids FREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVE
- Top Product
- Discover our top product Ralb Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RALB Blocking Peptide, catalog no. 33R-3044, is also available for use as a blocking control in assays to test for specificity of this RALB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RALB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RALB (Ralb) (V-Ral Simian Leukemia Viral Oncogene Homolog B (Ras Related, GTP Binding Protein) (Ralb))
- Alternative Name
- RALB (Ralb Products)
- Synonyms
- dRalb antibody, 5730472O18Rik antibody, Ral B antibody, ralb antibody, xralb antibody, zgc:100801 antibody, KRAS2 antibody, k-ras antibody, RAS like proto-oncogene B antibody, v-ral simian leukemia viral oncogene B antibody, v-ral simian leukemia viral oncogene homolog B L homeolog antibody, v-ral simian leukemia viral oncogene homolog Ba (ras related) antibody, v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein) antibody, RALB antibody, Ralb antibody, ralb.L antibody, ralba antibody, ralb antibody
- Background
- This gene encodes a GTP-binding protein that belongs to the small GTPase superfamily and Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors.
- Molecular Weight
- 23 kDa (MW of target protein)
- Pathways
- Neurotrophin Signaling Pathway, CXCR4-mediated Signaling Events
-