AKR1C2 antibody

Catalog No. ABIN632618

Product Details anti-AKR1C2 Antibody

Target: AKR1C2 (Aldo-keto Reductase Family 1, Member C2 (AKR1C2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AKR1C2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: AKR1 C2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AKR1C2 Blocking Peptide, catalog no. 33R-4880, is also available for use as a blocking control in assays to test for specificity of this AKR1C2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKR0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AKR1C2

Target: AKR1C2 (Aldo-keto Reductase Family 1, Member C2 (AKR1C2))

Alternative Name: AKR1C2 (AKR1C2 Products)

Synonyms: AKR1C-pseudo antibody, BABP antibody, DD antibody, DD2 antibody, DDH2 antibody, HAKRD antibody, HBAB antibody, MCDR2 antibody, SRXY8 antibody, Akr1c21 antibody, aldo-keto reductase family 1 member C2 antibody, aldo-keto reductase family 1, member C2 antibody, AKR1C2 antibody, Akr1c2 antibody

Background: This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols using NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme binds bile acid with high affinity, and shows minimal 3-alpha-hydroxysteroid dehydrogenase activity. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14.

Molecular Weight: 37 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis, C21-Steroid Hormone Metabolic Process