CNDP2 antibody
-
- Target See all CNDP2 Antibodies
- CNDP2 (CNDP Dipeptidase 2 (Metallopeptidase M20 Family) (CNDP2))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CNDP2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- CNDP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALEAYQKTGQEIPVNVRFCLEGMEESGSEGLDELIFARKDTFFKDVDYVC
- Top Product
- Discover our top product CNDP2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CNDP2 Blocking Peptide, catalog no. 33R-1325, is also available for use as a blocking control in assays to test for specificity of this CNDP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNDP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CNDP2 (CNDP Dipeptidase 2 (Metallopeptidase M20 Family) (CNDP2))
- Alternative Name
- CNDP2 (CNDP2 Products)
- Synonyms
- 0610010E05Rik antibody, C76600 antibody, Cn2 antibody, Dip-2 antibody, Pep-1 antibody, Pep1 antibody, CN2 antibody, CPGL antibody, HsT2298 antibody, PEPA antibody, cn2 antibody, cpgl antibody, darmin-r antibody, CNDP2 antibody, zgc:92569 antibody, wu:fd20d11 antibody, wu:fe17f09 antibody, cndp2b antibody, PEPC1 antibody, PEPCase antibody, PPC1 antibody, PPEPC4 antibody, pepc antibody, carnosine dipeptidase 2 antibody, CNDP dipeptidase 2 (metallopeptidase M20 family) antibody, CNDP dipeptidase 2 (metallopeptidase M20 family) S homeolog antibody, CNDP dipeptidase 2 (metallopeptidase M20 family) L homeolog antibody, phosphoenolpyruvate carboxylase 1 antibody, Cndp2 antibody, CNDP2 antibody, cndp2 antibody, cndp2.S antibody, cndp2.L antibody, pep1 antibody
- Background
- CNDP2, also known as tissue carnosinase and peptidase A (EC 3.4.13.18), is a nonspecific dipeptidase rather than a selective carnosinase.
- Molecular Weight
- 53 kDa (MW of target protein)
-