FAM82B antibody (N-Term)

Catalog No. ABIN632672

Product Details anti-FAM82B Antibody

Target: FAM82B (RMDN1) (Regulator of Microtubule Dynamics 1 (RMDN1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM82B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM82 B antibody was raised against the N terminal of FAM82

Purification: Affinity purified

Immunogen: FAM82 B antibody was raised using the N terminal of FAM82 corresponding to a region with amino acids MALAARLWRLLPFRRGAAPGSRLPAGTSGSRGHCGPCRFRGFEVMGNPGT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM82B Blocking Peptide, catalog no. 33R-5682, is also available for use as a blocking control in assays to test for specificity of this FAM82B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM80 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM82B

Target: FAM82B (RMDN1) (Regulator of Microtubule Dynamics 1 (RMDN1))

Alternative Name: FAM82B (RMDN1 Products)

Synonyms: Fam82b antibody, RMD-1 antibody, FAM82B antibody, RMD1 antibody, fam82b antibody, rmdn1 antibody, regulator of microtubule dynamics 1 antibody, Regulator of microtubule dynamics protein 1 antibody, regulator of microtubule dynamics 1 S homeolog antibody, Rmdn1 antibody, RMDN1 antibody, rmd-1 antibody, rmdn1.S antibody

Background: The specific function of FAM82B is not yet known.

Molecular Weight: 36 kDa (MW of target protein)