Acap3 antibody (N-Term)
-
- Target See all Acap3 Antibodies
- Acap3 (ArfGAP with Coiled-Coil, Ankyrin Repeat and PH Domains 3 (Acap3))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Acap3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CENTB5 antibody was raised against the N terminal of CENTB5
- Purification
- Affinity purified
- Immunogen
- CENTB5 antibody was raised using the N terminal of CENTB5 corresponding to a region with amino acids LQSFVKEDVRKFKETKKQFDKVREDLELSLVRNAQAPRHRPHEVEEATGA
- Top Product
- Discover our top product Acap3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CENTB5 Blocking Peptide, catalog no. 33R-5340, is also available for use as a blocking control in assays to test for specificity of this CENTB5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CENTB5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Acap3 (ArfGAP with Coiled-Coil, Ankyrin Repeat and PH Domains 3 (Acap3))
- Alternative Name
- CENTB5 (Acap3 Products)
- Synonyms
- CENTB5 antibody, Centb5 antibody, Kiaa1716-hp antibody, mKIAA1716 antibody, ArfGAP with coiled-coil, ankyrin repeat and PH domains 3 antibody, arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 3 antibody, ACAP3 antibody, LOC100568277 antibody, Acap3 antibody
- Background
- CENTB5 is a GTPase-activating protein for the ADP ribosylation factor family.
- Molecular Weight
- 85 kDa (MW of target protein)
-