GPRASP2 antibody (Middle Region)
-
- Target See all GPRASP2 Antibodies
- GPRASP2 (G Protein-Coupled Receptor Associated Sorting Protein 2 (GPRASP2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GPRASP2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GPRASP2 antibody was raised against the middle region of GPRASP2
- Purification
- Affinity purified
- Immunogen
- GPRASP2 antibody was raised using the middle region of GPRASP2 corresponding to a region with amino acids EQESLLQPDQPSPEFTFQYDPSYRSVREIREHLRARESAESESWSCSCIQ
- Top Product
- Discover our top product GPRASP2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GPRASP2 Blocking Peptide, catalog no. 33R-2662, is also available for use as a blocking control in assays to test for specificity of this GPRASP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPRASP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GPRASP2 (G Protein-Coupled Receptor Associated Sorting Protein 2 (GPRASP2))
- Alternative Name
- GPRASP2 (GPRASP2 Products)
- Synonyms
- GASP2 antibody, 5330440H13Rik antibody, Prpl5 antibody, RGD1561019 antibody, G protein-coupled receptor associated sorting protein 2 antibody, GPRASP2 antibody, Gprasp2 antibody
- Background
- The function of FAM14A protein has not been widely studied, and is yet to be fully elucidated.
- Molecular Weight
- 94 kDa (MW of target protein)
-