FAM81A antibody (N-Term)

Catalog No. ABIN632737

Product Details anti-FAM81A Antibody

Target: FAM81A (Family with Sequence Similarity 81, Member A (FAM81A))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM81A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM81 A antibody was raised against the N terminal of FAM81

Purification: Affinity purified

Immunogen: FAM81 A antibody was raised using the N terminal of FAM81 corresponding to a region with amino acids GDRLARLFLEEHIRNITAIVKQLNRDIEVLQEQIRARDNISYGTNSALKT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM81A Blocking Peptide, catalog no. 33R-3209, is also available for use as a blocking control in assays to test for specificity of this FAM81A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM80 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM81A

Target: FAM81A (Family with Sequence Similarity 81, Member A (FAM81A))

Alternative Name: FAM81A (FAM81A Products)

Synonyms: 6430514L14Rik antibody, RGD1311958 antibody, family with sequence similarity 81, member A antibody, family with sequence similarity 81 member A antibody, Fam81a antibody, FAM81A antibody

Background: The function of FAM81 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 42 kDa (MW of target protein)