LACC1 antibody (Middle Region)

Catalog No. ABIN632755

Product Details anti-LACC1 Antibody

Target: LACC1 (C13orf31) (Chromosome 13 Open Reading Frame 31 (C13orf31))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LACC1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C13 ORF31 antibody was raised against the middle region of C13 rf31

Purification: Affinity purified

Immunogen: C13 ORF31 antibody was raised using the middle region of C13 rf31 corresponding to a region with amino acids TIITSSLIPDIFIHGFTTRTGGISYIPTLSSFNLFSSSKRRDPKVVVQEN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C13ORF31 Blocking Peptide, catalog no. 33R-9117, is also available for use as a blocking control in assays to test for specificity of this C13ORF31 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF31 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LACC1

Target: LACC1 (C13orf31) (Chromosome 13 Open Reading Frame 31 (C13orf31))

Alternative Name: C13ORF31 (C13orf31 Products)

Synonyms: C17H13orf31 antibody, c13orf31 antibody, C13orf31 antibody, 9030625A04Rik antibody, laccase domain containing 1 antibody, laccase (multicopper oxidoreductase) domain containing 1 L homeolog antibody, LACC1 laccase domain containing 1 antibody, laccase (multicopper oxidoreductase) domain containing 1 antibody, LACC1 antibody, lacc1.L antibody, Lacc1 antibody

Background: The function of C13orf31 has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 48 kDa (MW of target protein)