HSPE1 antibody
-
- Target See all HSPE1 Antibodies
- HSPE1 (Heat Shock 10kDa Protein 1 (Chaperonin 10) (HSPE1))
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HSPE1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- HSPE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD
- Top Product
- Discover our top product HSPE1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HSPE1 Blocking Peptide, catalog no. 33R-3360, is also available for use as a blocking control in assays to test for specificity of this HSPE1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPE1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HSPE1 (Heat Shock 10kDa Protein 1 (Chaperonin 10) (HSPE1))
- Alternative Name
- HSPE1 (HSPE1 Products)
- Synonyms
- CPN10 antibody, EPF antibody, GROES antibody, HSP10 antibody, groS antibody, Cpn10 antibody, cpn10 antibody, zgc:86747 antibody, hspe1 antibody, MGC89647 antibody, HSPE1 antibody, MITOCHONDRIAL CHAPERONIN 10 antibody, T15D22.2 antibody, T15D22_2 antibody, chaperonin 10 antibody, Dmel\\CG11267 antibody, Hsp10 antibody, anon-WO0118547.175 antibody, hsp10 antibody, crpB antibody, chpS antibody, 10kDa antibody, mt-cpn10 antibody, heat shock protein family E (Hsp10) member 1 antibody, molecular chaperone GroES antibody, chaperonin 10 kDa antibody, chaperonin, 10 kDa antibody, chaperonin-10 kDa antibody, heat shock protein family E member 1 antibody, heat shock 10 protein 1 antibody, heat shock protein family E (Hsp10) member 1 L homeolog antibody, heat shock 10kDa protein 1 (chaperonin 10) pseudogene antibody, 10 kd chaperonin antibody, chaperonin 10 antibody, Hsp10p antibody, co-chaperonin 10, mitochondrial antibody, CG11267 gene product from transcript CG11267-RA antibody, co-chaperonin GroES antibody, mitochondrial heat shock protein Hsp10 (predicted) antibody, chaperonin GroS antibody, Hsp10 10 kDa chaperonin GROES antibody, mitochondrial heat shock protein Hsp10 antibody, heat shock protein 10 antibody, heat shock protein 1 (chaperonin 10) antibody, heat shock 10kDa protein 1 (chaperonin 10) antibody, HSPE1 antibody, groES antibody, groES2 antibody, TP01_0190 antibody, Cag_1167 antibody, Bm1_56470 antibody, Hspe1 antibody, hspe1 antibody, hspe1.L antibody, LOC452179 antibody, Cpn10 antibody, CPN10 antibody, HSP10 antibody, CG11267 antibody, hsp10 antibody, groS antibody
- Background
- HSPE1 is a major heat shock protein which functions as a chaperonin. Its structure consists of a heptameric ring which binds to another heat shock protein in order to form a symmetric, functional heterodimer which enhances protein folding in an ATP-dependent manner.
- Molecular Weight
- 11 kDa (MW of target protein)
- Pathways
- Positive Regulation of Endopeptidase Activity
-