HSPE1 antibody

Catalog No. ABIN632792

The Rabbit Polyclonal anti-HSPE1 antibody is suitable to detect HSPE1 in samples from Human and Mouse. It has been validated for WB.

Quick Overview for HSPE1 antibody (ABIN632792)

Target: HSPE1 (Heat Shock 10kDa Protein 1 (Chaperonin 10) (HSPE1))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HSPE1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HSPE1 Antibody

Purification: Affinity purified

Immunogen: HSPE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HSPE1 Blocking Peptide, (ABIN938746), is also available for use as a blocking control in assays to test for specificity of this HSPE1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HSPE1

Target: HSPE1 (Heat Shock 10kDa Protein 1 (Chaperonin 10) (HSPE1))

Alternative Name: HSPE1

Background: HSPE1 is a major heat shock protein which functions as a chaperonin. Its structure consists of a heptameric ring which binds to another heat shock protein in order to form a symmetric, functional heterodimer which enhances protein folding in an ATP-dependent manner.

Molecular Weight: 11 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity