PDXDC1 antibody (N-Term)

Catalog No. ABIN632806

Product Details anti-PDXDC1 Antibody

Target: PDXDC1 (Pyridoxal-Dependent Decarboxylase Domain Containing 1 (PDXDC1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PDXDC1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PDXDC1 antibody was raised against the N terminal of PDXDC1

Purification: Affinity purified

Immunogen: PDXDC1 antibody was raised using the N terminal of PDXDC1 corresponding to a region with amino acids DEDEEPQSPRIQNIGEQGHMALLGHSLGAYISTLDKEKLRKLTTRILSDT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PDXDC1 Blocking Peptide, catalog no. 33R-1893, is also available for use as a blocking control in assays to test for specificity of this PDXDC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDXDC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PDXDC1

Target: PDXDC1 (Pyridoxal-Dependent Decarboxylase Domain Containing 1 (PDXDC1))

Alternative Name: PDXDC1 (PDXDC1 Products)

Synonyms: 2210010A19Rik antibody, AA415817 antibody, Kiaa0251-hp antibody, RGD1562597 antibody, LP8165 antibody, pdxdc1 antibody, wu:fj29c10 antibody, zgc:92179 antibody, pyridoxal-dependent decarboxylase domain containing 1 antibody, pyridoxal dependent decarboxylase domain containing 1 antibody, pyridoxal-dependent decarboxylase domain containing 1 L homeolog antibody, Pdxdc1 antibody, PDXDC1 antibody, pdxdc1.L antibody, pdxdc1 antibody

Background: PDXDC1 belongs to the group II decarboxylase family. The function of PDXDC1 remains unknown.

Molecular Weight: 87 kDa (MW of target protein)