PDZD9 antibody (Middle Region)

Catalog No. ABIN632838

Product Details anti-PDZD9 Antibody

Target: PDZD9 (PDZ Domain Containing 9 (PDZD9))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PDZD9 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C16 ORF65 antibody was raised against the middle region of C16 rf65

Purification: Affinity purified

Immunogen: C16 ORF65 antibody was raised using the middle region of C16 rf65 corresponding to a region with amino acids TSTPKKIELAKDESFTSSDDNENVDLDKRLQYYRYPWSTVHHPARRPISI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C16ORF65 Blocking Peptide, catalog no. 33R-9303, is also available for use as a blocking control in assays to test for specificity of this C16ORF65 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF65 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PDZD9

Target: PDZD9 (PDZ Domain Containing 9 (PDZD9))

Alternative Name: C16ORF65 (PDZD9 Products)

Synonyms: C16orf65 antibody, C25H16orf65 antibody, 4930408O21Rik antibody, LRRGT00105 antibody, PDZ domain containing 9 antibody, PDZD9 antibody, Pdzd9 antibody

Background: The function of Chromosome 16 ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 23 kDa (MW of target protein)