PDZD9 antibody (Middle Region)
-
- Target See all PDZD9 Antibodies
- PDZD9 (PDZ Domain Containing 9 (PDZD9))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PDZD9 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C16 ORF65 antibody was raised against the middle region of C16 rf65
- Purification
- Affinity purified
- Immunogen
- C16 ORF65 antibody was raised using the middle region of C16 rf65 corresponding to a region with amino acids TSTPKKIELAKDESFTSSDDNENVDLDKRLQYYRYPWSTVHHPARRPISI
- Top Product
- Discover our top product PDZD9 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C16ORF65 Blocking Peptide, catalog no. 33R-9303, is also available for use as a blocking control in assays to test for specificity of this C16ORF65 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF65 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PDZD9 (PDZ Domain Containing 9 (PDZD9))
- Alternative Name
- C16ORF65 (PDZD9 Products)
- Synonyms
- C16orf65 antibody, C25H16orf65 antibody, 4930408O21Rik antibody, LRRGT00105 antibody, PDZ domain containing 9 antibody, PDZD9 antibody, Pdzd9 antibody
- Background
- The function of Chromosome 16 ORF protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 23 kDa (MW of target protein)
-