FAM131C antibody (Middle Region)

Catalog No. ABIN632844

Product Details anti-FAM131C Antibody

Target: FAM131C (Family with Sequence Similarity 131, Member C (FAM131C))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM131C antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM131 C antibody was raised against the middle region of FAM131

Purification: Affinity purified

Immunogen: FAM131 C antibody was raised using the middle region of FAM131 corresponding to a region with amino acids RGRVAHLIEWKGWSAQPAGWELSPAEDEHYCCLPDELREARFAAGVAEQF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM131C Blocking Peptide, catalog no. 33R-7936, is also available for use as a blocking control in assays to test for specificity of this FAM131C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM130 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM131C

Target: FAM131C (Family with Sequence Similarity 131, Member C (FAM131C))

Alternative Name: FAM131C (FAM131C Products)

Synonyms: C1orf117 antibody, RP11-5P18.9 antibody, Gm693 antibody, family with sequence similarity 131 member C antibody, family with sequence similarity 131, member C antibody, FAM131C antibody, Fam131c antibody

Background: The function of FAM131 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 30 kDa (MW of target protein)