C9orf68 antibody (Middle Region)

Catalog No. ABIN632882

Product Details anti-C9orf68 Antibody

Target: C9orf68 (Chromosome 9 Open Reading Frame 68 (C9orf68))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C9orf68 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C9 ORF68 antibody was raised against the middle region of C9 rf68

Purification: Affinity purified

Immunogen: C9 ORF68 antibody was raised using the middle region of C9 rf68 corresponding to a region with amino acids CLDSSQFGKSSSSKQGDADFHGKASFATYQHSTSPGPLDQPLLRERFHPG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C9ORF68 Blocking Peptide, catalog no. 33R-1733, is also available for use as a blocking control in assays to test for specificity of this C9ORF68 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF68 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C9orf68

Target: C9orf68 (Chromosome 9 Open Reading Frame 68 (C9orf68))

Alternative Name: C9ORF68 (C9orf68 Products)

Synonyms: MGC131199 antibody, MGC146453 antibody, C9orf68 antibody, bA6J24.2 antibody, spermatogenesis associated 6-like L homeolog antibody, spermatogenesis associated 6-like antibody, spermatogenesis associated 6 like antibody, spata6l.L antibody, spata6l antibody, SPATA6L antibody

Background: The function of Chromosome 9 ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 45 kDa (MW of target protein)