TBC1D25 antibody (N-Term)

Catalog No. ABIN632894

The Rabbit Polyclonal anti-TBC1D25 antibody has been validated for WB. It is suitable to detect TBC1D25 in samples from Human, Mouse and Rat.

Quick Overview for TBC1D25 antibody (N-Term) (ABIN632894)

Target: TBC1D25 (TBC1 Domain Family, Member 25 (TBC1D25))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TBC1D25 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TBC1D25 Antibody

Binding Specificity: N-Term

Specificity: TBC1 D25 antibody was raised against the N terminal of TBC1 25

Purification: Affinity purified

Immunogen: TBC1 D25 antibody was raised using the N terminal of TBC1 25 corresponding to a region with amino acids KVQQVLSWSYGEDVKPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TBC1D25 Blocking Peptide, (ABIN940107), is also available for use as a blocking control in assays to test for specificity of this TBC1D25 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 25 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TBC1D25

Target: TBC1D25 (TBC1 Domain Family, Member 25 (TBC1D25))

Alternative Name: TBC1D25

Background: This gene encodes a protein with a TBC domain and may function as a Rab GTPase activating protein. This gene was previously known as ornithine aminotransferase-like 1, but has no similarity to ornithine aminotransferase.

Molecular Weight: 76 kDa (MW of target protein)