CNOT11 antibody (N-Term)

Catalog No. ABIN632925

Product Details anti-CNOT11 Antibody

Target: CNOT11 (CCR4-NOT Transcription Complex, Subunit 11 (CNOT11))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CNOT11 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C2 ORF29 antibody was raised against the N terminal Of C2 rf29

Purification: Affinity purified

Immunogen: C2 ORF29 antibody was raised using the N terminal Of C2 rf29 corresponding to a region with amino acids NPFAASFAHLLNPAPPARGGQEPDRPPLSGFLPPITPPEKFFLSQLMLAP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C2ORF29 Blocking Peptide, catalog no. 33R-6815, is also available for use as a blocking control in assays to test for specificity of this C2ORF29 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF29 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CNOT11

Target: CNOT11 (CCR4-NOT Transcription Complex, Subunit 11 (CNOT11))

Alternative Name: C2ORF29 (CNOT11 Products)

Synonyms: C2orf29 antibody, 2410015L18Rik antibody, C40 antibody, D1Bwg0212e antibody, RGD1560909 antibody, fj49e01 antibody, wu:fj49e01 antibody, zgc:163002 antibody, CCR4-NOT transcription complex subunit 11 antibody, CCR4-NOT transcription complex, subunit 11 antibody, CNOT11 antibody, Cnot11 antibody, cnot11 antibody

Background: The function of Chromosome 2 ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 55 kDa (MW of target protein)