CCDC87 antibody (N-Term)
-
- Target See all CCDC87 Antibodies
- CCDC87 (Coiled-Coil Domain Containing 87 (CCDC87))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CCDC87 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CCDC87 antibody was raised against the N terminal of CCDC87
- Purification
- Affinity purified
- Immunogen
- CCDC87 antibody was raised using the N terminal of CCDC87 corresponding to a region with amino acids MMEPPKPEPELQRFYHRLLRPLSLFPTRTTSPEPQKRPPQEGRILQSFPL
- Top Product
- Discover our top product CCDC87 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CCDC87 Blocking Peptide, catalog no. 33R-6230, is also available for use as a blocking control in assays to test for specificity of this CCDC87 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC87 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CCDC87 (Coiled-Coil Domain Containing 87 (CCDC87))
- Alternative Name
- CCDC87 (CCDC87 Products)
- Synonyms
- 4931419P11Rik antibody, coiled-coil domain containing 87 antibody, CCDC87 antibody, Ccdc87 antibody
- Background
- The function of CCDC87 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 96 kDa (MW of target protein)
-