LRRC20 antibody (Middle Region)

Catalog No. ABIN632945

Product Details anti-LRRC20 Antibody

Target: LRRC20 (Leucine Rich Repeat Containing 20 (LRRC20))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LRRC20 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LRRC20 antibody was raised against the middle region of LRRC20

Purification: Affinity purified

Immunogen: LRRC20 antibody was raised using the middle region of LRRC20 corresponding to a region with amino acids TTFSQLRELHLEGNFLHRLPSEVSALQHLKAIDLSRNQFQDFPEQLTALP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LRRC20 Blocking Peptide, catalog no. 33R-9314, is also available for use as a blocking control in assays to test for specificity of this LRRC20 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LRRC20

Target: LRRC20 (Leucine Rich Repeat Containing 20 (LRRC20))

Alternative Name: LRRC20 (LRRC20 Products)

Synonyms: BC036304 antibody, leucine rich repeat containing 20 antibody, LRRC20 antibody, Lrrc20 antibody

Background: The function of LRRC20 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 20 kDa (MW of target protein)