ACTR10 antibody
-
- Target See all ACTR10 Antibodies
- ACTR10 (Actin-Related Protein 10 Homolog (ACTR10))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ACTR10 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ACTR10 antibody was raised using a synthetic peptide corresponding to a region with amino acids SLIQCPIDTRKQLAENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKYKKAL
- Top Product
- Discover our top product ACTR10 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ACTR10 Blocking Peptide, catalog no. 33R-8598, is also available for use as a blocking control in assays to test for specificity of this ACTR10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTR10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACTR10 (Actin-Related Protein 10 Homolog (ACTR10))
- Alternative Name
- ACTR10 (ACTR10 Products)
- Synonyms
- ACTR11 antibody, Arp11 antibody, HARP11 antibody, Actr11 antibody, actin related protein 10 homolog antibody, actin-related protein 10 homolog antibody, ARP10 actin-related protein 10 antibody, ACTR10 antibody, Actr10 antibody
- Background
- ACTR10 may be involved in protein binding.
- Molecular Weight
- 46 kDa (MW of target protein)
-