FAM36A antibody (Middle Region)

Catalog No. ABIN632967

Product Details anti-FAM36A Antibody

Target: FAM36A (Family with Sequence Similarity 36, Member A (FAM36A))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM36A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM36 A antibody was raised against the middle region of FAM36

Purification: Affinity purified

Immunogen: FAM36 A antibody was raised using the middle region of FAM36 corresponding to a region with amino acids LGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM36A Blocking Peptide, catalog no. 33R-4967, is also available for use as a blocking control in assays to test for specificity of this FAM36A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM36A

Target: FAM36A (Family with Sequence Similarity 36, Member A (FAM36A))

Alternative Name: FAM36A (FAM36A Products)

Synonyms: FAM36A antibody, 2310005N03Rik antibody, Fam36a antibody, RGD1309105 antibody, cox20 antibody, fam36a antibody, COX20, cytochrome c oxidase assembly factor antibody, COX20 Cox2 chaperone antibody, COX20 cytochrome C oxidase assembly factor antibody, COX20 cytochrome c oxidase assembly factor L homeolog antibody, COX20 antibody, Cox20 antibody, cox20.L antibody

Background: FAM36A is a multi-pass membrane protein. It belongs to the FAM36 family. The exact function of FAM36A remains unknown.

Molecular Weight: 13 kDa (MW of target protein)