C6orf154 antibody (N-Term)

Catalog No. ABIN633006

Product Details anti-C6orf154 Antibody

Target: C6orf154 (Chromosome 6 Open Reading Frame 154 (C6orf154))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C6orf154 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C6 orf154 antibody was raised against the N terminal of C6 rf154

Purification: Affinity purified

Immunogen: C6 orf154 antibody was raised using the N terminal of C6 rf154 corresponding to a region with amino acids MLPSSIQISGEPLSGAEVRDICRGLRDNAVRLLSLRGCRLCDRDFGRICR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C6orf154 Blocking Peptide, catalog no. 33R-6203, is also available for use as a blocking control in assays to test for specificity of this C6orf154 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 rf154 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C6orf154

Target: C6orf154 (Chromosome 6 Open Reading Frame 154 (C6orf154))

Alternative Name: C6orf154 (C6orf154 Products)

Synonyms: C6orf154 antibody, LRRC73 antibody, nod3l antibody, leucine rich repeat containing 73 antibody, LRRC73 antibody, Lrrc73 antibody

Background: The function of Chromosome 6 ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 33 kDa (MW of target protein)