ERMN antibody (Middle Region)

Catalog No. ABIN633019

Product Details anti-ERMN Antibody

Target: ERMN (Ermin, ERM-Like Protein (ERMN))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ERMN antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KIAA1189 antibody was raised against the middle region of Kiaa1189

Purification: Affinity purified

Immunogen: KIAA1189 antibody was raised using the middle region of Kiaa1189 corresponding to a region with amino acids RVIEFKKKHEEVSQFKEEGDASEDSPLSSASSQAVTPDEQPTLGKKSDIS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KIAA1189 Blocking Peptide, catalog no. 33R-8249, is also available for use as a blocking control in assays to test for specificity of this KIAA1189 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA1189 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ERMN

Target: ERMN (Ermin, ERM-Like Protein (ERMN))

Alternative Name: KIAA1189 (ERMN Products)

Synonyms: JN antibody, KIAA1189 antibody, ermin antibody, A330104H05Rik antibody, AI854460 antibody, mKIAA1189 antibody, RGD1308367 antibody, juxtanodin antibody, ermin antibody, ermin, ERM-like protein antibody, ERMN antibody, Ermn antibody

Background: The function of KIAA1189 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 34 kDa (MW of target protein)