UTP14A antibody

Catalog No. ABIN633033

Product Details anti-UTP14A Antibody

Target: UTP14A (UTP14, U3 Small Nucleolar Ribonucleoprotein, Homolog A (UTP14A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UTP14A antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: UTP14 A antibody was raised using a synthetic peptide corresponding to a region with amino acids KWDPVVLKNRQAEQLVFPLEKEEPAIAPIEHVLSGWKARTPLEQEIFNLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UTP14A Blocking Peptide, catalog no. 33R-4729, is also available for use as a blocking control in assays to test for specificity of this UTP14A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UTP10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UTP14A

Target: UTP14A (UTP14, U3 Small Nucleolar Ribonucleoprotein, Homolog A (UTP14A))

Alternative Name: UTP14A (UTP14A Products)

Synonyms: NYCO16 antibody, SDCCAG16 antibody, dJ537K23.3 antibody, 2700066J21Rik antibody, JsdX antibody, NY-CO-16 antibody, T25628 antibody, mKIAA0266 antibody, UTP14C antibody, UTP14A antibody, utp14a antibody, UTP14A, small subunit processome component antibody, UTP14A small subunit processome component antibody, UTP14, U3 small nucleolar ribonucleoprotein, homolog A-like antibody, U3 small nucleolar RNA-associated protein 14 homolog A antibody, UTP14A, small subunit processome component L homeolog antibody, UTP14A antibody, Utp14a antibody, LOC505600 antibody, LOC100083222 antibody, utp14a.L antibody

Background: This gene encodes a member of the uridine triphosphate 14 family. As an essential component of a large ribonucleoprotein complex bound to the U3 small nucleolar RNA, the encoded protein is involved in ribosome biogenesis and 18S rRNA synthesis. An autosomal retrotransposed copy of this X-linked gene exists on chromosome 13. Alternative splicing results in multiple transcript variants.

Molecular Weight: 88 kDa (MW of target protein)