Tec Protein Tyrosine Kinase (TEC) (Middle Region) antibody

Catalog No. ABIN633042

The Rabbit Polyclonal anti-Tec Protein Tyrosine Kinase antibody (ABIN633042) specifically detects Tec Protein Tyrosine Kinase in WB. The antibody is reactive with Human samples.

Quick Overview for Tec Protein Tyrosine Kinase (TEC) (Middle Region) antibody (ABIN633042)

Target: Tec Protein Tyrosine Kinase (TEC)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Product Details

Binding Specificity: Middle Region

Specificity: TEC antibody was raised against the middle region of TEC

Purification: Affinity purified

Immunogen: TEC antibody was raised using the middle region of TEC corresponding to a region with amino acids VKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYSRFSSKSDVWSFG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TEC Blocking Peptide, (ABIN5616549), is also available for use as a blocking control in assays to test for specificity of this TEC antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TEC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Tec Protein Tyrosine Kinase (TEC)

Alternative Name: TEC

Background: The protein encoded by this gene belongs to the Tec family of non-receptor protein-tyrosine kinases containing a pleckstrin homology domain. Tec family kinases are involved in the intracellular signaling mechanisms of cytokine receptors, lymphocyte surface antigens, heterotrimeric G-protein coupled receptors, and integrin molecules. They are also key players in the regulation of the immune functions. Tec kinase is an integral component of T cell signaling and has a distinct role in T cell activation. This gene may be associated with myelodysplastic syndrome.

Molecular Weight: 73 kDa (MW of target protein)

Pathways: Fc-epsilon Receptor Signaling Pathway