NXPH3 antibody (N-Term)

Catalog No. ABIN633043

Product Details anti-NXPH3 Antibody

Target: NXPH3 (Neurexophilin 3 (NXPH3))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NXPH3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Neurexophilin 3 antibody was raised against the N terminal of NXPH3

Purification: Affinity purified

Immunogen: Neurexophilin 3 antibody was raised using the N terminal of NXPH3 corresponding to a region with amino acids RDDHEGQPRPRVPRKRGHISPKSRPMANSTLLGLLAPPGEAWGILGQPPN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Neurexophilin 3 Blocking Peptide, catalog no. 33R-7840, is also available for use as a blocking control in assays to test for specificity of this Neurexophilin 3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NXPH3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NXPH3

Target: NXPH3 (Neurexophilin 3 (NXPH3))

Alternative Name: Neurexophilin 3 (NXPH3 Products)

Synonyms: NPH3 antibody, Nph3 antibody, neurexophilin 3 antibody, neurexophilin 3 S homeolog antibody, NXPH3 antibody, nxph3.S antibody, nxph3 antibody, Nxph3 antibody

Background: NXPH3 may be signaling molecules that resemble neuropeptides. Ligand for alpha-neurexins.

Molecular Weight: 28 kDa (MW of target protein)