NXPH3 antibody (N-Term)
-
- Target See all NXPH3 Antibodies
- NXPH3 (Neurexophilin 3 (NXPH3))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NXPH3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Neurexophilin 3 antibody was raised against the N terminal of NXPH3
- Purification
- Affinity purified
- Immunogen
- Neurexophilin 3 antibody was raised using the N terminal of NXPH3 corresponding to a region with amino acids RDDHEGQPRPRVPRKRGHISPKSRPMANSTLLGLLAPPGEAWGILGQPPN
- Top Product
- Discover our top product NXPH3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Neurexophilin 3 Blocking Peptide, catalog no. 33R-7840, is also available for use as a blocking control in assays to test for specificity of this Neurexophilin 3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NXPH3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NXPH3 (Neurexophilin 3 (NXPH3))
- Alternative Name
- Neurexophilin 3 (NXPH3 Products)
- Synonyms
- NPH3 antibody, Nph3 antibody, neurexophilin 3 antibody, neurexophilin 3 S homeolog antibody, NXPH3 antibody, nxph3.S antibody, nxph3 antibody, Nxph3 antibody
- Background
- NXPH3 may be signaling molecules that resemble neuropeptides. Ligand for alpha-neurexins.
- Molecular Weight
- 28 kDa (MW of target protein)
-