CRLF2 antibody (Middle Region)

Catalog No. ABIN633053

Product Details anti-CRLF2 Antibody

Target: CRLF2 (Cytokine Receptor-Like Factor 2 (CRLF2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CRLF2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CRLF2 antibody was raised against the middle region of CRLF2

Purification: Affinity purified

Immunogen: CRLF2 antibody was raised using the middle region of CRLF2 corresponding to a region with amino acids FWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSKF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CRLF2 Blocking Peptide, catalog no. 33R-3132, is also available for use as a blocking control in assays to test for specificity of this CRLF2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRLF2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CRLF2

Target: CRLF2 (Cytokine Receptor-Like Factor 2 (CRLF2))

Alternative Name: CRLF2 (CRLF2 Products)

Synonyms: CRLF2 antibody, CRL2 antibody, CRLF2Y antibody, TSLPR antibody, CRLM2 antibody, Ly114 antibody, Tpte2 antibody, Tslpr antibody, Crl2 antibody, cytokine receptor like factor 2 antibody, cytokine receptor-like factor 2 antibody, CRLF2 antibody, Crlf2 antibody

Background: Cytokine signals are mediated through specific receptor complexes, the components of which are mostly members of the type I cytokine receptor family. Type I cytokine receptors share conserved structural features in their extracellular domain. Receptor complexes are typically heterodimeric, consisting of alpha chains, which provide ligand specificity, and beta (or gamma) chains, which are required for the formation of high-affinity binding sites and signal transduction.

Molecular Weight: 29 kDa (MW of target protein)