RABEPK antibody (N-Term)
-
- Target See all RABEPK Antibodies
- RABEPK (Rab9 Effector Protein with Kelch Motifs (RABEPK))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RABEPK antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RABEPK antibody was raised against the N terminal of RABEPK
- Purification
- Affinity purified
- Immunogen
- RABEPK antibody was raised using the N terminal of RABEPK corresponding to a region with amino acids SCSYLPPVGNAKRGKVFIVGGANPNRSFSDVHTMDLGKHQWDLDTCKGLL
- Top Product
- Discover our top product RABEPK Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RABEPK Blocking Peptide, catalog no. 33R-8341, is also available for use as a blocking control in assays to test for specificity of this RABEPK antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RABEPK antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RABEPK (Rab9 Effector Protein with Kelch Motifs (RABEPK))
- Alternative Name
- RABEPK (RABEPK Products)
- Synonyms
- RAB9P40 antibody, bA65N13.1 antibody, p40 antibody, 8430412M01Rik antibody, 9530020D24Rik antibody, AV073337 antibody, C87311 antibody, Rab9p40 antibody, 9530020d24rik antibody, RGD1310612 antibody, Rab9 effector protein with kelch motifs antibody, Rab9 effector protein with kelch motifs L homeolog antibody, RABEPK antibody, Rabepk antibody, rabepk.L antibody, rabepk antibody
- Background
- RABEPK is a rab9 effector required for endosome to trans-Golgi network (TGN) transport.
- Molecular Weight
- 40 kDa (MW of target protein)
-