TUBB4 antibody (N-Term)

Catalog No. ABIN633077

Product Details anti-TUBB4 Antibody

Target: TUBB4 (TUBB4A) (Tubulin beta 4a (TUBB4A))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TUBB4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Beta Tubulin 4 antibody was raised against the N terminal of TUBB4

Purification: Affinity purified

Immunogen: Beta Tubulin 4 antibody was raised using the N terminal of TUBB4 corresponding to a region with amino acids TYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Beta Tubulin 4 Blocking Peptide, catalog no. 33R-9390, is also available for use as a blocking control in assays to test for specificity of this Beta Tubulin 4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBB4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TUBB4

Target: TUBB4 (TUBB4A) (Tubulin beta 4a (TUBB4A))

Abstract: TUBB4A Products

Synonyms: DYT4 antibody, HLD6 antibody, TUBB4 antibody, TUBB5 antibody, beta-5 antibody, AI325297 antibody, M(beta)4 antibody, Tubb antibody, Tubb4 antibody, betatub56d antibody, tubb2 antibody, tubb2c antibody, tubb4 antibody, tubb4a antibody, tubb5 antibody, tubulin beta 4A class IVa antibody, tubulin, beta 4A class IVA antibody, tubulin, beta 4A class IVa antibody, tubulin beta 4B class IVb L homeolog antibody, Tubulin beta-4A chain antibody, tubulin beta 4A class IVa S homeolog antibody, TUBB4A antibody, Tubb4a antibody, tubb4b.L antibody, tubb4a.S antibody

Background: Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.

Molecular Weight: 49 kDa (MW of target protein)