STK38L antibody (Middle Region)
-
- Target See all STK38L Antibodies
- STK38L (serine/threonine Kinase 38 Like (STK38L))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This STK38L antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- STK38 L antibody was raised against the middle region of STK38
- Purification
- Affinity purified
- Immunogen
- STK38 L antibody was raised using the middle region of STK38 corresponding to a region with amino acids PAAIPIEIKSIDDTSNFDDFPESDILQPVPNTTEPDYKSKDWVFLNYTYK
- Top Product
- Discover our top product STK38L Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
STK38L Blocking Peptide, catalog no. 33R-6952, is also available for use as a blocking control in assays to test for specificity of this STK38L antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STK30 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- STK38L (serine/threonine Kinase 38 Like (STK38L))
- Alternative Name
- STK38L (STK38L Products)
- Synonyms
- RGD1564793 antibody, NDR2 antibody, 4930473A22Rik antibody, B230328I19 antibody, Ndr2 antibody, Ndr54 antibody, serine/threonine kinase 38 like antibody, Stk38l antibody, STK38L antibody
- Background
- STK38L is involved in the regulation of structural processes in differentiating and mature neuronal cells.
- Molecular Weight
- 54 kDa (MW of target protein)
-