NUBP1 antibody

Catalog No. ABIN633112

Product Details anti-NUBP1 Antibody

Target: NUBP1 (Nucleotide Binding Protein 1 (NUBP1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NUBP1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: NUBP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NUBP1 Blocking Peptide, catalog no. 33R-5911, is also available for use as a blocking control in assays to test for specificity of this NUBP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUBP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NUBP1

Target: NUBP1 (Nucleotide Binding Protein 1 (NUBP1))

Alternative Name: NUBP1 (NUBP1 Products)

Synonyms: DDBDRAFT_0169230 antibody, DDBDRAFT_0232424 antibody, DDB_0169230 antibody, DDB_0232424 antibody, NBP antibody, NBP1 antibody, nbp antibody, nbp1 antibody, nubp1 antibody, NBP 1 antibody, im:7144207 antibody, zgc:92138 antibody, nucleotide binding protein 1 antibody, nucleotide binding protein 1 (MinD homolog, E. coli) antibody, nucleotide binding protein 1 L homeolog antibody, nucleotide binding protein 1 S homeolog antibody, Nubp1 antibody, nubp1 antibody, NUBP1 antibody, nubp1.L antibody, nubp1.S antibody

Background: NUBP1 is a member of the NUBP/MRP subfamily of ATP-binding proteins.

Molecular Weight: 34 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis