RFTN2 antibody (N-Term)

Catalog No. ABIN633116

Product Details anti-RFTN2 Antibody

Target: RFTN2 (Raftlin Family Member 2 (RFTN2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RFTN2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RFTN2 antibody was raised against the N terminal of RFTN2

Purification: Affinity purified

Immunogen: RFTN2 antibody was raised using the N terminal of RFTN2 corresponding to a region with amino acids MGCGLRKLEDPDDSSPGKIFSTLKRPQVETKTEFAYEYVLLDFTLQASSN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RFTN2 Blocking Peptide, catalog no. 33R-6014, is also available for use as a blocking control in assays to test for specificity of this RFTN2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RFTN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RFTN2

Target: RFTN2 (Raftlin Family Member 2 (RFTN2))

Alternative Name: RFTN2 (RFTN2 Products)

Synonyms: RGD1307304 antibody, zgc:56544 antibody, wu:fi98e03 antibody, Raftlin-2 antibody, DKFZp459I212 antibody, C2orf11 antibody, 2700010E02Rik antibody, 3222401M22Rik antibody, raftlin family member 2 antibody, Rftn2 antibody, RFTN2 antibody, rftn2 antibody

Background: The function of the protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 56 kDa (MW of target protein)