RAPGEF3 antibody
-
- Target See all RAPGEF3 Antibodies
- RAPGEF3 (Rap Guanine Nucleotide Exchange Factor (GEF) 3 (RAPGEF3))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RAPGEF3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- RAPGEF3 antibody was raised using a synthetic peptide corresponding to a region with amino acids HGKVVLVLERASQGAGPSRPPTPGRNRYTVMSGTPEKILELLLEAMGPDS
- Top Product
- Discover our top product RAPGEF3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RAPGEF3 Blocking Peptide, catalog no. 33R-3740, is also available for use as a blocking control in assays to test for specificity of this RAPGEF3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAPGEF3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RAPGEF3 (Rap Guanine Nucleotide Exchange Factor (GEF) 3 (RAPGEF3))
- Alternative Name
- RAPGEF3 (RAPGEF3 Products)
- Synonyms
- RAPGEF3 antibody, epac antibody, si:dkey-27m20.2 antibody, CAMP-GEFI antibody, EPAC antibody, EPAC1 antibody, HSU79275 antibody, bcm910 antibody, 2310016P22Rik antibody, 9330170P05Rik antibody, Epac antibody, Epac1 antibody, Rap guanine nucleotide exchange factor 3 antibody, Rap guanine nucleotide exchange factor 3 S homeolog antibody, Rap guanine nucleotide exchange factor (GEF) 3 antibody, RAPGEF3 antibody, rapgef3.S antibody, rapgef3 antibody, Rapgef3 antibody
- Background
- RAPGEF3 is a guanine nucleotide exchange factor (GEF) for RAP1A and RAP2A small GTPases that is activated by binding cAMP.
- Molecular Weight
- 104 kDa (MW of target protein)
- Pathways
- cAMP Metabolic Process
-