RAPGEF3 antibody

Catalog No. ABIN633119

Product Details anti-RAPGEF3 Antibody

Target: RAPGEF3 (Rap Guanine Nucleotide Exchange Factor (GEF) 3 (RAPGEF3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAPGEF3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: RAPGEF3 antibody was raised using a synthetic peptide corresponding to a region with amino acids HGKVVLVLERASQGAGPSRPPTPGRNRYTVMSGTPEKILELLLEAMGPDS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAPGEF3 Blocking Peptide, catalog no. 33R-3740, is also available for use as a blocking control in assays to test for specificity of this RAPGEF3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAPGEF3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAPGEF3

Target: RAPGEF3 (Rap Guanine Nucleotide Exchange Factor (GEF) 3 (RAPGEF3))

Alternative Name: RAPGEF3 (RAPGEF3 Products)

Synonyms: RAPGEF3 antibody, epac antibody, si:dkey-27m20.2 antibody, CAMP-GEFI antibody, EPAC antibody, EPAC1 antibody, HSU79275 antibody, bcm910 antibody, 2310016P22Rik antibody, 9330170P05Rik antibody, Epac antibody, Epac1 antibody, Rap guanine nucleotide exchange factor 3 antibody, Rap guanine nucleotide exchange factor 3 S homeolog antibody, Rap guanine nucleotide exchange factor (GEF) 3 antibody, RAPGEF3 antibody, rapgef3.S antibody, rapgef3 antibody, Rapgef3 antibody

Background: RAPGEF3 is a guanine nucleotide exchange factor (GEF) for RAP1A and RAP2A small GTPases that is activated by binding cAMP.

Molecular Weight: 104 kDa (MW of target protein)

Pathways: cAMP Metabolic Process