ALDH1A1 antibody (Middle Region)

Catalog No. ABIN633157

Product Details anti-ALDH1A1 Antibody

Target: ALDH1A1 (Aldehyde Dehydrogenase 1 Family, Member A1 (ALDH1A1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ALDH1A1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ALDH1 A1 antibody was raised against the middle region of ALDH1 1

Purification: Affinity purified

Immunogen: ALDH1 A1 antibody was raised using the middle region of ALDH1 1 corresponding to a region with amino acids SVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ALDH1A1 Blocking Peptide, catalog no. 33R-8907, is also available for use as a blocking control in assays to test for specificity of this ALDH1A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ALDH1A1

Target: ALDH1A1 (Aldehyde Dehydrogenase 1 Family, Member A1 (ALDH1A1))

Alternative Name: ALDH1A1 (ALDH1A1 Products)

Synonyms: ALDC antibody, ALDH-E1 antibody, ALDH1 antibody, ALDH11 antibody, PUMB1 antibody, RALDH1 antibody, AL1A1 antibody, aldc antibody, aldh-e1 antibody, aldh1 antibody, aldh11 antibody, pumb1 antibody, raldh1 antibody, GGADHR antibody, ALDH1A1 antibody, ALDDH antibody, Ahd2 antibody, Aldh1 antibody, Aldh2 antibody, Ahd-2 antibody, Aldh1a2 antibody, E1 antibody, Raldh1 antibody, Aldh1a1 antibody, ALHDII antibody, RALDH 1 antibody, RalDH1 antibody, aldehyde dehydrogenase 1 family member A1 antibody, aldehyde dehydrogenase 1 family, member A1 antibody, aldehyde dehydrogenase 1 family member A1 L homeolog antibody, aldehyde dehydrogenase family 1, subfamily A1 antibody, aldehyde dehydrogenase antibody, retinal dehydrogenase 1 antibody, ALDH1A1 antibody, aldh1a1 antibody, Aldh1a1 antibody, aldh1a1.L antibody, aldH1 antibody, LOC100732581 antibody, LOC101822890 antibody

Background: This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of this enzyme, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of Orientals have only the cytosolic isozyme, missing the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among Orientals than among Caucasians could be related to the absence of the mitochondrial isozyme. This gene encodes a cytosolic isoform, which has a high affinity for aldehydes.

Molecular Weight: 55 kDa (MW of target protein)

Pathways: Dopaminergic Neurogenesis