FHIT antibody (Middle Region)

Catalog No. ABIN633160

Product Details anti-FHIT Antibody

Target: FHIT (Fragile Histidine Triad (FHIT))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FHIT antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FHIT antibody was raised against the middle region of FHIT

Purification: Affinity purified

Immunogen: FHIT antibody was raised using the middle region of FHIT corresponding to a region with amino acids VHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FHIT Blocking Peptide, catalog no. 33R-9585, is also available for use as a blocking control in assays to test for specificity of this FHIT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FHIT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FHIT

Target: FHIT (Fragile Histidine Triad (FHIT))

Alternative Name: FHIT (FHIT Products)

Background: This gene, a member of the histidine triad gene family, encodes a diadenosine 5',5'''-P1,P3-triphosphate hydrolase involved in purine metabolism. The gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts of this gene. In fact, aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas. Alternatively spliced transcript variants have been found for this gene.

Molecular Weight: 17 kDa (MW of target protein)