NBEAL1 antibody (N-Term)

Catalog No. ABIN633188

Product Details anti-NBEAL1 Antibody

Target: NBEAL1 (Neurobeachin-Like 1 (NBEAL1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NBEAL1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NBEAL1 antibody was raised against the N terminal of NBEAL1

Purification: Affinity purified

Immunogen: NBEAL1 antibody was raised using the N terminal of NBEAL1 corresponding to a region with amino acids KDNDKNMSTEDTKKNSDEKTDEEKITSFASANVSSDQWSLEDRHSLDSNT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NBEAL1 Blocking Peptide, catalog no. 33R-4298, is also available for use as a blocking control in assays to test for specificity of this NBEAL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NBEAL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NBEAL1

Target: NBEAL1 (Neurobeachin-Like 1 (NBEAL1))

Alternative Name: NBEAL1 (NBEAL1 Products)

Synonyms: A530083I02Rik antibody, ALS2CR16 antibody, ALS2CR17 antibody, neurobeachin like 1 antibody, NBEAL1 antibody

Background: NBEAL1 belongs to the WD repeat neurobeachin family. It contains 1 BEACH domain and 2 WD repeats. NBEAL1 is highly expressed in brain, kidney, prostate and testis and weakly expressed in ovary, small intestine, colon and peripheral blood leukocytes. It may be correlative to several tumors, such as ovary serous adenocarcinoma and metastasis mammary gland carcinoma breast.

Molecular Weight: 153 kDa (MW of target protein)