TDRD9 antibody (Middle Region)

Catalog No. ABIN633194

Product Details anti-TDRD9 Antibody

Target: TDRD9 (Tudor Domain Containing 9 (TDRD9))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TDRD9 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TDRD9 antibody was raised against the middle region of TDRD9

Purification: Affinity purified

Immunogen: TDRD9 antibody was raised using the middle region of TDRD9 corresponding to a region with amino acids AINIRDVLIQQGYAELTEESYESKQSHEVLKGLFSKSVENMTDGSVPFPM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TDRD9 Blocking Peptide, catalog no. 33R-1276, is also available for use as a blocking control in assays to test for specificity of this TDRD9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TDRD9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TDRD9

Target: TDRD9 (Tudor Domain Containing 9 (TDRD9))

Alternative Name: TDRD9 (TDRD9 Products)

Synonyms: MGC146806 antibody, C14orf75 antibody, HIG-1 antibody, NET54 antibody, 4930441E05Rik antibody, si:dkey-15f17.9 antibody, tdrd9l antibody, tudor domain containing 9 antibody, TDRD9 antibody, tdrd9 antibody, Tdrd9 antibody

Background: TDRD9 contains 1 helicase ATP-binding domain and 1 helicase C-terminal domain. The exact function of TDRD9 is not known.

Molecular Weight: 103 kDa (MW of target protein)