SF3B3 antibody (Middle Region)

Catalog No. ABIN633217

Product Details anti-SF3B3 Antibody

Target: SF3B3 (Splicing Factor 3b, Subunit 3, 130kDa (SF3B3))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SF3B3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SF3 B3 antibody was raised against the middle region of SF3 3

Purification: Affinity purified

Immunogen: SF3 B3 antibody was raised using the middle region of SF3 3 corresponding to a region with amino acids EHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SF3B3 Blocking Peptide, catalog no. 33R-2457, is also available for use as a blocking control in assays to test for specificity of this SF3B3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SF3B3

Target: SF3B3 (Splicing Factor 3b, Subunit 3, 130kDa (SF3B3))

Alternative Name: SF3B3 (SF3B3 Products)

Synonyms: GB11574 antibody, rse1 antibody, sap130 antibody, sf3b130 antibody, staf130 antibody, sf3b3 antibody, 1810061H24Rik antibody, 5730409A01Rik antibody, AA409318 antibody, D8Ertd633e antibody, RSE1 antibody, SAP130 antibody, mKIAA0017 antibody, ik:tdsubc_2b2 antibody, wu:fb81f05 antibody, xx:tdsubc_2b2 antibody, zgc:55440 antibody, SF3b130 antibody, STAF130 antibody, splicing factor 3b subunit 3 antibody, splicing factor 3B subunit 3 antibody, splicing factor 3b, subunit 3, 130kDa antibody, splicing factor 3b subunit 3 L homeolog antibody, splicing factor 3b, subunit 3 antibody, SF3B3 antibody, LOC550935 antibody, sf3b3 antibody, Sf3b3 antibody, LOC100178056 antibody, sf3b3.L antibody

Background: SF3B3 is subunit 3 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. Subunit 3 has also been identified as a component of the STAGA (SPT3-TAF(II)31-GCN5L acetylase) transcription coactivator-HAT (histone acetyltransferase) complex, and the TFTC (TATA-binding-protein-free TAF(II)-containing complex). These complexes may function in chromatin modification, transcription, splicing, and DNA repair.

Molecular Weight: 135 kDa (MW of target protein)