PRPF4 antibody

Catalog No. ABIN633223

Product Details anti-PRPF4 Antibody

Target: PRPF4 (PRP4 Pre-mRNA Processing Factor 4 Homolog (PRPF4))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRPF4 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PRPF4 antibody was raised using a synthetic peptide corresponding to a region with amino acids EVFEIEEHISERQAEVLAEFERRKRARQINVSTDDSEVKACLRALGEPIT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRPF4 Blocking Peptide, catalog no. 33R-2784, is also available for use as a blocking control in assays to test for specificity of this PRPF4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRPF4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRPF4

Target: PRPF4 (PRP4 Pre-mRNA Processing Factor 4 Homolog (PRPF4))

Alternative Name: PRPF4 (PRPF4 Products)

Synonyms: zgc:65943 antibody, mg:ab03a02 antibody, GB19235 antibody, DDBDRAFT_0187564 antibody, DDBDRAFT_0233058 antibody, DDB_0187564 antibody, DDB_0233058 antibody, HPRP4 antibody, HPRP4P antibody, PRP4 antibody, Prp4p antibody, SNRNP60 antibody, 1600015H11Rik antibody, AI874830 antibody, AW047464 antibody, bN189G18.1 antibody, pre-mRNA processing factor 4 antibody, PRP4 pre-mRNA processing factor 4 homolog (yeast) antibody, pre-mRNA processing factor 4 L homeolog antibody, U4/U6 small nuclear ribonucleoprotein Prp4 antibody, U4/U6 small nuclear ribonucleoprotein antibody, Prpf4 antibody, prpf4 antibody, prpf4.L antibody, PRPF4 antibody, LOC409689 antibody

Background: The removal of introns from nuclear pre-mRNAs occurs on complexes called spliceosomes, which are made up of 4 small nuclear ribonucleoprotein (snRNP) particles and an undefined number of transiently associated splicing factors.

Molecular Weight: 58 kDa (MW of target protein)