HNRNPC antibody
-
- Target See all HNRNPC Antibodies
- HNRNPC (Heterogeneous Nuclear Ribonucleoprotein C (C1/C2) (HNRNPC))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HNRNPC antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- HNRPC antibody was raised using a synthetic peptide corresponding to a region with amino acids LDINLAAEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLLSSSFDLDYDFQ
- Top Product
- Discover our top product HNRNPC Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HNRPC Blocking Peptide, catalog no. 33R-4848, is also available for use as a blocking control in assays to test for specificity of this HNRPC antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPC antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HNRNPC (Heterogeneous Nuclear Ribonucleoprotein C (C1/C2) (HNRNPC))
- Alternative Name
- HNRPC (HNRNPC Products)
- Synonyms
- C1 antibody, C2 antibody, HNRNP antibody, HNRPC antibody, SNRPC antibody, MGC53243 antibody, HNRNPC antibody, bZ1G18.4 antibody, fb57h12 antibody, fi16b11 antibody, wu:fb57h12 antibody, wu:fi16b11 antibody, zgc:55701 antibody, AL022939 antibody, D14Wsu171e antibody, Hnrpc antibody, Hnrpc1 antibody, Hnrpc2 antibody, hnRNPC1 antibody, hnRNPC2 antibody, hnrnp-C antibody, hnRNP C antibody, hnrnp antibody, hnrpc antibody, snrpc antibody, heterogeneous nuclear ribonucleoprotein C (C1/C2) antibody, heterogeneous nuclear ribonucleoprotein C (C1/C2) S homeolog antibody, heterogeneous nuclear ribonucleoprotein C antibody, heterogeneous nuclear ribonucleoprotein C (C1/C2) L homeolog antibody, HNRNPC antibody, hnrnpc.S antibody, hnrnpc antibody, Hnrnpc antibody, hnrnpc.L antibody
- Background
- HNRPC belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein can act as a tetramer and is involved in the assembly of 40S hnRNP particles.
- Molecular Weight
- 33 kDa (MW of target protein)
-