HNRNPUL1 antibody (Middle Region)
-
- Target See all HNRNPUL1 Antibodies
- HNRNPUL1 (Heterogeneous Nuclear Ribonucleoprotein U-Like 1 (HNRNPUL1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HNRNPUL1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- HNRPUL1 antibody was raised against the middle region of Hnrpul1
- Purification
- Affinity purified
- Immunogen
- HNRPUL1 antibody was raised using the middle region of Hnrpul1 corresponding to a region with amino acids LPDVGDFLDEVLFIELQREEADKLVRQYNEEGRKAGPPPEKRFDNRGGGG
- Top Product
- Discover our top product HNRNPUL1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HNRPUL1 Blocking Peptide, catalog no. 33R-5262, is also available for use as a blocking control in assays to test for specificity of this HNRPUL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPUL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HNRNPUL1 (Heterogeneous Nuclear Ribonucleoprotein U-Like 1 (HNRNPUL1))
- Alternative Name
- HNRPUL1 (HNRNPUL1 Products)
- Synonyms
- HNRPUL1 antibody, E1B-AP5 antibody, E1BAP5 antibody, E130317O14Rik antibody, Hnrnpul antibody, Hnrpul1 antibody, hnrpul1 antibody, wu:fb53d10 antibody, wu:fk45c03 antibody, zgc:85971 antibody, heterogeneous nuclear ribonucleoprotein U like 1 antibody, coiled-coil domain containing 97 antibody, heterogeneous nuclear ribonucleoprotein U-like 1 antibody, HNRNPUL1 antibody, CCDC97 antibody, Desac_1308 antibody, Hnrnpul1 antibody, hnrnpul1 antibody
- Background
- HNRPUL1 is a nuclear RNA-binding protein of the heterogeneous nuclear ribonucleoprotein (hnRNP) family. This protein binds specifically to adenovirus E1B-55kDa oncoprotein. It may play an important role in nucleocytoplasmic RNA transport.
- Molecular Weight
- 85 kDa (MW of target protein)
-