HNRNPUL1 antibody (Middle Region)

Catalog No. ABIN633257

The Rabbit Polyclonal anti-HNRNPUL1 antibody is suitable to detect HNRNPUL1 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for HNRNPUL1 antibody (Middle Region) (ABIN633257)

Target: HNRNPUL1 (Heterogeneous Nuclear Ribonucleoprotein U-Like 1 (HNRNPUL1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HNRNPUL1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HNRNPUL1 Antibody

Binding Specificity: Middle Region

Specificity: HNRPUL1 antibody was raised against the middle region of Hnrpul1

Purification: Affinity purified

Immunogen: HNRPUL1 antibody was raised using the middle region of Hnrpul1 corresponding to a region with amino acids LPDVGDFLDEVLFIELQREEADKLVRQYNEEGRKAGPPPEKRFDNRGGGG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HNRPUL1 Blocking Peptide, (ABIN5614052), is also available for use as a blocking control in assays to test for specificity of this HNRPUL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPUL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HNRNPUL1

Target: HNRNPUL1 (Heterogeneous Nuclear Ribonucleoprotein U-Like 1 (HNRNPUL1))

Alternative Name: HNRPUL1

Background: HNRPUL1 is a nuclear RNA-binding protein of the heterogeneous nuclear ribonucleoprotein (hnRNP) family. This protein binds specifically to adenovirus E1B-55kDa oncoprotein. It may play an important role in nucleocytoplasmic RNA transport.

Molecular Weight: 85 kDa (MW of target protein)