EXOSC2 antibody (Middle Region)

Catalog No. ABIN633278

Product Details anti-EXOSC2 Antibody

Target: EXOSC2 (Exosome Component 2 (EXOSC2))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EXOSC2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EXOSC2 antibody was raised against the middle region of EXOSC2

Purification: Affinity purified

Immunogen: EXOSC2 antibody was raised using the middle region of EXOSC2 corresponding to a region with amino acids AEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EXOSC2 Blocking Peptide, catalog no. 33R-1154, is also available for use as a blocking control in assays to test for specificity of this EXOSC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOSC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EXOSC2

Target: EXOSC2 (Exosome Component 2 (EXOSC2))

Alternative Name: EXOSC2 (EXOSC2 Products)

Synonyms: EXOSC2 antibody, exosc2 antibody, MGC97533 antibody, RRP4 antibody, Rrp4p antibody, hRrp4p antibody, p7 antibody, Rrp4 antibody, fa97b01 antibody, wu:fa97b01 antibody, zgc:110117 antibody, exosome component 2 antibody, exosome component 2 L homeolog antibody, EXOSC2 antibody, exosc2 antibody, Bm1_33895 antibody, PTRG_00114 antibody, Exosc2 antibody, exosc2.L antibody

Background: EXOSC2 belongs to the exosome, a RNA-processing complex, which is at least involved in the 3' processing of the 7S pre-rRNA to the mature 5.8S rRNA. It exhibits a 3'-5' exoribonuclease activity.

Molecular Weight: 32 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome