DND1 antibody
-
- Target See all DND1 Antibodies
- DND1 (Dead End Homolog 1 (DND1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DND1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DND1 antibody was raised using a synthetic peptide corresponding to a region with amino acids HRFWYQVVIPGHPVPFSGLIWVVLTLDGRDGHEVAKDAVSVRLLQALSES
- Top Product
- Discover our top product DND1 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DND1 Blocking Peptide, catalog no. 33R-3840, is also available for use as a blocking control in assays to test for specificity of this DND1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DND1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DND1 (Dead End Homolog 1 (DND1))
- Alternative Name
- DND1 (DND1 Products)
- Synonyms
- dnd antibody, xde antibody, Xdead antibody, rbms4 antibody, dead-end antibody, DND1 antibody, BC034897 antibody, RBMS4 antibody, Ter antibody, DND microRNA-mediated repression inhibitor 1 antibody, dead end protein homolog 1 pseudogene antibody, dnd1 antibody, LOC100349427 antibody, DND1 antibody, Dnd1 antibody
- Background
- DND1 contains 2 RRM (RNA recognition motif) domains. It may play a role during primordial germ cell (PGC) development. However, DND1 does not seem to be essential for PGC migration.
- Molecular Weight
- 39 kDa (MW of target protein)
-