XPO1 antibody
-
- Target See all XPO1 Antibodies
- XPO1 (Exportin 1 (XPO1))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This XPO1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- XPO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSH
- Top Product
- Discover our top product XPO1 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
XPO1 Blocking Peptide, catalog no. 33R-6744, is also available for use as a blocking control in assays to test for specificity of this XPO1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XPO1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- XPO1 (Exportin 1 (XPO1))
- Alternative Name
- XPO1 (XPO1 Products)
- Synonyms
- CG13387 antibody, CRM1 antibody, Crm1 antibody, DCRM1 antibody, Dmel\\CG13387 antibody, Emb antibody, XPO-1 antibody, XPO1 antibody, Xpo1 antibody, crm1 antibody, dCRM1 antibody, l(2)k16715 antibody, 18.m06600 antibody, DDBDRAFT_0183812 antibody, DDBDRAFT_0234066 antibody, DDB_0183812 antibody, DDB_0234066 antibody, exportin-1 antibody, LOC100220104 antibody, emb antibody, exp1 antibody, Xpo antibody, AA420417 antibody, Exp1 antibody, embargoed antibody, exportin 1 antibody, putative exportin 1 antibody, chromosome region maintenance protein 1 antibody, exportin-1 antibody, exportin 1 (CRM1 homolog, yeast) antibody, exportin 1 S homeolog antibody, emb antibody, cgd3_3060 antibody, Tc00.1047053511725.150 antibody, Tb11.01.5940 antibody, BBOV_II007220 antibody, LMJF_32_1100 antibody, xpo1 antibody, Xpo1 antibody, XPO1 antibody, LOC100165622 antibody, LOC100633509 antibody, xpo1.S antibody
- Background
- XPO1 mediates leucine-rich nuclear export signal (NES)-dependent protein transport. Exportin 1 specifically inhibits the nuclear export of Rev and U snRNAs. It is involved in the control of several cellular processes by controlling the localization of cyclin B, MPAK, and MAPKAP kinase 2. XPO1 also regulates NFAT and AP-1.
- Molecular Weight
- 123 kDa (MW of target protein)
- Pathways
- M Phase
-