TTC14 antibody (N-Term)
-
- Target See all TTC14 Antibodies
- TTC14 (Tetratricopeptide Repeat Domain 14 (TTC14))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TTC14 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TTC14 antibody was raised against the N terminal of TTC14
- Purification
- Affinity purified
- Immunogen
- TTC14 antibody was raised using the N terminal of TTC14 corresponding to a region with amino acids LLSLLRSEQQDNPHFRSLLGSAAEPARGPPPQHPLQGRKEKRVDNIEIQK
- Top Product
- Discover our top product TTC14 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TTC14 Blocking Peptide, catalog no. 33R-5194, is also available for use as a blocking control in assays to test for specificity of this TTC14 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTC14 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TTC14 (Tetratricopeptide Repeat Domain 14 (TTC14))
- Alternative Name
- TTC14 (TTC14 Products)
- Synonyms
- DRDL5813 antibody, PRO19630 antibody, 2700016E08Rik antibody, 4930434D01Rik antibody, 4931403I22Rik antibody, 4933402I15Rik antibody, AI662468 antibody, AU014779 antibody, AW561908 antibody, cI-44 antibody, mKIAA1980 antibody, zgc:113259 antibody, tetratricopeptide repeat domain 14 antibody, TTC14 antibody, Ttc14 antibody, ttc14 antibody
- Background
- TTC14 belongs to the TTC14 family and contains 1 S1 motif domain and 4 TPR repeats. The functions of TTC14 remain unknown.
- Molecular Weight
- 88 kDa (MW of target protein)
-