CSTF3 antibody (N-Term)

Catalog No. ABIN633455

Product Details anti-CSTF3 Antibody

Target: CSTF3 (Cleavage Stimulation Factor, 3' Pre-RNA, Subunit 3, 77kDa (CSTF3))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CSTF3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CSTF3 antibody was raised against the N terminal of CSTF3

Purification: Affinity purified

Immunogen: CSTF3 antibody was raised using the N terminal of CSTF3 corresponding to a region with amino acids YIEAEIKAKNYDKVEKLFQRCLMKVLHIDLWKCYLSYVRETKGKLPSYKE

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CSTF3 Blocking Peptide, catalog no. 33R-10133, is also available for use as a blocking control in assays to test for specificity of this CSTF3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSTF3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CSTF3

Target: CSTF3 (Cleavage Stimulation Factor, 3' Pre-RNA, Subunit 3, 77kDa (CSTF3))

Alternative Name: CSTF3 (CSTF3 Products)

Synonyms: cstf3 antibody, MGC76035 antibody, CSTF3 antibody, wu:fa99c02 antibody, wu:fb18b09 antibody, zgc:56028 antibody, 4732468G05Rik antibody, C79532 antibody, CstF-77 antibody, cstf3a antibody, CSTF-77 antibody, cleavage stimulation factor, 3' pre-RNA, subunit 3 antibody, cleavage stimulation factor subunit 3 antibody, cstf3 antibody, CSTF3 antibody, LOC100544392 antibody, LOC100641283 antibody, Cstf3 antibody, cstf3.S antibody

Background: CSTF3 is one of three (including CSTF1 and CSTF2) cleavage stimulation factors that combine to form the cleavage stimulation factor complex (CSTF). This complex is involved in the polyadenylation and 3' end cleavage of pre-mRNAs. The protein functions as a homodimer and interacts directly with both CSTF1 and CSTF2 in the CSTF complex.

Molecular Weight: 79 kDa (MW of target protein)