EIF2S1 antibody (N-Term)
-
- Target See all EIF2S1 Antibodies
- EIF2S1 (Eukaryotic Translation Initiation Factor 2 Subunit 1 (EIF2S1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat, Mouse, Drosophila melanogaster
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This EIF2S1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- EIF2 S1 antibody was raised against the N terminal of EIF2 1
- Purification
- Affinity purified
- Immunogen
- EIF2 S1 antibody was raised using the N terminal of EIF2 1 corresponding to a region with amino acids VVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
- Top Product
- Discover our top product EIF2S1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
EIF2S1 Blocking Peptide, catalog no. 33R-9903, is also available for use as a blocking control in assays to test for specificity of this EIF2S1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EIF2S1 (Eukaryotic Translation Initiation Factor 2 Subunit 1 (EIF2S1))
- Alternative Name
- EIF2S1 (EIF2S1 Products)
- Synonyms
- EIF-2 antibody, EIF-2A antibody, EIF-2alpha antibody, EIF2 antibody, EIF2A antibody, Eif2s1 antibody, eif2s1l antibody, fb36a08 antibody, wu:fb36a08 antibody, zgc:56510 antibody, 0910001O23Rik antibody, 2410026C18Rik antibody, 35kDa antibody, Eif2a antibody, eIF2alpha antibody, eif2a antibody, CG9946 antibody, Dmel\\CG9946 antibody, Eif2alpha antibody, IF2A_DROME antibody, M(1)14C antibody, M(1)19-153 antibody, M(1)8e3-10 antibody, deIF2alpha antibody, eIF-2 antibody, eIF-2 a antibody, eIF-2 alpha antibody, eIF2 alpha antibody, eIF2-alpha antibody, eIF2a antibody, eiF-2alpha antibody, elF2alpha antibody, l(1)14Cf antibody, l(1)19-153 antibody, eukaryotic translation initiation factor 2 subunit alpha antibody, eukaryotic translation initiation factor 2, subunit 1 alpha a antibody, eukaryotic translation initiation factor 2, subunit 1 alpha antibody, eukaryotic translation initiation factor 2 alpha subunit antibody, Eukaryotic translation initiation factor 2 subunit 1 antibody, eukaryotic translation initiation factor 2 subunit alpha L homeolog antibody, eukaryotic translation Initiation Factor 2alpha antibody, EIF2S1 antibody, eif2s1a antibody, Eif2s1 antibody, eif2s1 antibody, LOC693063 antibody, CNI00230 antibody, THAPSDRAFT_105 antibody, if2a antibody, eif2s1.L antibody, eIF-2alpha antibody
- Background
- The translation initiation factor eIF2 catalyzes the first regulated step of protein synthesis initiation, promoting the binding of the initiator tRNA to 40S ribosomal subunits. Binding occurs as a ternary complex of methionyl-tRNA, eIF2, and GTP.
- Molecular Weight
- 36 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, ER-Nucleus Signaling, Hepatitis C
-