EIF2S2 antibody (N-Term)
-
- Target See all EIF2S2 Antibodies
- EIF2S2 (Eukaryotic Translation Initiation Factor 2, Subunit 2 Beta, 38kDa (EIF2S2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This EIF2S2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- EIF2 S2 antibody was raised against the N terminal of EIF2 2
- Purification
- Affinity purified
- Immunogen
- EIF2 S2 antibody was raised using the N terminal of EIF2 2 corresponding to a region with amino acids DEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKD
- Top Product
- Discover our top product EIF2S2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
EIF2S2 Blocking Peptide, catalog no. 33R-1911, is also available for use as a blocking control in assays to test for specificity of this EIF2S2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EIF2S2 (Eukaryotic Translation Initiation Factor 2, Subunit 2 Beta, 38kDa (EIF2S2))
- Alternative Name
- EIF2S2 (EIF2S2 Products)
- Synonyms
- EIF2 antibody, EIF2B antibody, EIF2beta antibody, PPP1R67 antibody, eIF-2-beta antibody, 2810026E11Rik antibody, 38kDa antibody, AA408636 antibody, AA571381 antibody, AA986487 antibody, AW822225 antibody, D2Ertd303e antibody, zgc:77084 antibody, wu:fc26g03 antibody, wu:fu10f07 antibody, MGC130959 antibody, DDBDRAFT_0205105 antibody, DDBDRAFT_0234112 antibody, DDB_0205105 antibody, DDB_0234112 antibody, AO090005001412 antibody, eukaryotic translation initiation factor 2 subunit beta antibody, eukaryotic translation initiation factor 2, subunit 2 (beta) antibody, eukaryotic translation initiation factor 2, subunit 2 beta antibody, eukaryotic translation initiation factor 2 subunit beta L homeolog antibody, eIF-3 beta antibody, hypothetical protein antibody, eukaryotic translation initiation factor 2 subunit 2 antibody, EIF2S2 antibody, Eif2s2 antibody, eif2s2 antibody, eif2s2.L antibody, eIF2s2 antibody, TP02_0678 antibody, EDI_093670 antibody, AOR_1_2450174 antibody, MGYG_05853 antibody, PGTG_10708 antibody, LOC101111733 antibody
- Background
- Eukaryotic translation initiation factor 2 (EIF-2) functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA and binding to a 40S ribosomal subunit. EIF-2 is composed of three subunits, alpha, beta, and gamma, with the protein encoded by this gene representing the beta subunit. The beta subunit catalyzes the exchange of GDP for GTP, which recycles the EIF-2 complex for another round of initiation.
- Molecular Weight
- 38 kDa (MW of target protein)
-