EIF4B antibody (Middle Region)
-
- Target See all EIF4B Antibodies
- EIF4B (Eukaryotic Translation Initiation Factor 4B (EIF4B))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This EIF4B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- EIF4 B antibody was raised against the middle region of EIF4
- Purification
- Affinity purified
- Immunogen
- EIF4 B antibody was raised using the middle region of EIF4 corresponding to a region with amino acids QTGNSSRGPGDGGNRDHWKESDRKDGKKDQDSRSAPEPKKPEENPASKFS
- Top Product
- Discover our top product EIF4B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
EIF4B Blocking Peptide, catalog no. 33R-7750, is also available for use as a blocking control in assays to test for specificity of this EIF4B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EIF4B (Eukaryotic Translation Initiation Factor 4B (EIF4B))
- Alternative Name
- EIF4B (EIF4B Products)
- Synonyms
- EIF-4B antibody, PRO1843 antibody, CG10837 antibody, Dm-eIF4B antibody, Dmel\\CG10837 antibody, Eif4B antibody, eIF-4B-L antibody, eIF-4B-S antibody, eIF-4b antibody, eIF4B antibody, eIF4B-L antibody, eIF4B-S antibody, eIf4b antibody, 2310046H11Rik antibody, AL024095 antibody, C85189 antibody, Eif4a2 antibody, eif4b antibody, fb15c09 antibody, wu:fb15c09 antibody, zgc:101532 antibody, MGC89384 antibody, eukaryotic translation initiation factor 4B antibody, eukaryotic initiation factor 4B antibody, Eukaryotic initiation factor 4B antibody, eukaryotic translation initiation factor 4Bb antibody, eukaryotic translation initiation factor 4Ba antibody, eukaryotic translation initiation factor 4B S homeolog antibody, EIF4B antibody, Eif4B antibody, eIF-4B antibody, Eif4b antibody, eif4bb antibody, eif4b antibody, eif4ba antibody, eif4b.S antibody, LOC100284982 antibody, LOC100380867 antibody
- Background
- IF4B contains 1 RRM (RNA recognition motif) domain and is required for the binding of mRNA to ribosomes. Functions of EIF4B are in close association with EEF4-F and EIF4-A. It binds near the 5'-terminal cap of mRNA in presence of EIF-4F and ATP and promotes the ATPase activity and the ATP-dependent RNA unwinding activity of both EIF4-A and EIF4-F.
- Molecular Weight
- 69 kDa (MW of target protein)
-