RPF1 antibody (N-Term)

Catalog No. ABIN633541

Product Details anti-RPF1 Antibody

Target: RPF1 (Brix Domain Containing 5 (RPF1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPF1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: BXDC5 antibody was raised against the N terminal of BXDC5

Purification: Affinity purified

Immunogen: BXDC5 antibody was raised using the N terminal of BXDC5 corresponding to a region with amino acids AAAFPPGFSISEIKNKQRRHLMFTRWKQQQRKEKLAAKKKLKKEREALGD

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BXDC5 Blocking Peptide, catalog no. 33R-1004, is also available for use as a blocking control in assays to test for specificity of this BXDC5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BXDC5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPF1

Target: RPF1 (Brix Domain Containing 5 (RPF1))

Alternative Name: BXDC5 (RPF1 Products)

Synonyms: bxdc5 antibody, zgc:86604 antibody, MGC86358 antibody, BXDC5 antibody, MGC145697 antibody, RP11-118B23.1 antibody, 2210420E24Rik antibody, 2310066N05Rik antibody, Bxdc5 antibody, rpf1 antibody, ribosome production factor 1 homolog antibody, ribosome production factor 1 homolog L homeolog antibody, RNA processing factor 1 antibody, rpf1 antibody, RPF1 antibody, rpf1.L antibody, Rpf1 antibody, bxdc5 antibody

Background: BXDC5 may be required for ribosome biogenesis.

Molecular Weight: 38 kDa (MW of target protein)