RPUSD3 antibody (Middle Region)

Catalog No. ABIN633554

Product Details anti-RPUSD3 Antibody

Target: RPUSD3 (RNA Pseudouridylate Synthase Domain Containing 3 (RPUSD3))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPUSD3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RPUSD3 antibody was raised against the middle region of RPUSD3

Purification: Affinity purified

Immunogen: RPUSD3 antibody was raised using the middle region of RPUSD3 corresponding to a region with amino acids MVLQLCPVLGDHMYSARVGTVLGQRFLLPAENNKPQRQVLDEALLRRLHL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPUSD3 Blocking Peptide, catalog no. 33R-6594, is also available for use as a blocking control in assays to test for specificity of this RPUSD3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPUSD3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPUSD3

Target: RPUSD3 (RNA Pseudouridylate Synthase Domain Containing 3 (RPUSD3))

Alternative Name: RPUSD3 (RPUSD3 Products)

Synonyms: AI527266 antibody, RGD1307582 antibody, RNA pseudouridylate synthase domain containing 3 antibody, RPUSD3 antibody, Rpusd3 antibody

Background: The specific function of RPUSD3 is not yet known.

Molecular Weight: 37 kDa (MW of target protein)